PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr041921.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 388aa    MW: 42452.1 Da    PI: 4.8668
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr041921.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.8e-164186147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd  l ++v  +G ++W++Iar +  gR++k+c++rw + 
      Pbr041921.1 41 KGPWSPEEDAVLSRLVSNFGARNWSLIARGID-GRSGKSCRLRWCNQ 86
                     79******************************.***********985 PP

2Myb_DNA-binding53.27e-1793137147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T  Ed+ +v a++ +G++ W++Iar ++ gRt++ +k++w++ 
      Pbr041921.1  93 RKPFTDAEDQMIVAAHAVHGNK-WAAIARLLP-GRTDNAIKNHWNST 137
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.8723687IPR017930Myb domain
SuperFamilySSF466896.36E-2939134IPR009057Homeodomain-like
SMARTSM007178.5E-134089IPR001005SANT/Myb domain
PfamPF002495.8E-154186IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-254294IPR009057Homeodomain-like
CDDcd001671.76E-124385No hitNo description
PROSITE profilePS5129425.83388142IPR017930Myb domain
SMARTSM007176.4E-1692140IPR001005SANT/Myb domain
PfamPF002494.1E-1493137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2395141IPR009057Homeodomain-like
CDDcd001679.55E-1295138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MEMEVADDPA AVDIDAGDSG EEAAAGGGAG SRRKSGRDNV KGPWSPEEDA VLSRLVSNFG  60
ARNWSLIARG IDGRSGKSCR LRWCNQLDPA VKRKPFTDAE DQMIVAAHAV HGNKWAAIAR  120
LLPGRTDNAI KNHWNSTLKR RCMDPEKIKL ESGNMVEDVS LDKTKGSSEE TFSYGDVNSS  180
KSMEGREVSS FQHMDDQDEY NGSSEVQFSH EATEQPNLFR PVARISAFSV YNQSNSQEPE  240
SSFPRPIPVQ GPLLRESKLD VGISKFLEGV YGELSVPDQC AHGCCCAQNG MNFQNSLGPE  300
FMEFSEPPSF PSFELAAIAT DISNLAWLKS GLENNSVRGM SDAAGRITTN ESQGKMGRFE  360
DSRTNHLFPV EERNDRLMGM KTNVLST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-39381414107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAPTransfer from AT3G09230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744590.0DQ074459.1 Malus x domestica MYB2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009346994.10.0PREDICTED: myb-related protein 306-like
TrEMBLQ2LMF30.0Q2LMF3_MALDO; MYB2
STRINGVIT_08s0007g01540.t011e-172(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39863362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.11e-89myb domain protein 1